PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_07775-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 173aa    MW: 19621.6 Da    PI: 10.4071
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_07775-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.5e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  TRIUR3_07775-P1 14 KGPWTAEEDQKLVGFLLTHGHYCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************99**********99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-21562IPR009057Homeodomain-like
PROSITE profilePS5129420.234965IPR017930Myb domain
SMARTSM007175.3E-111363IPR001005SANT/Myb domain
PfamPF002493.8E-131461IPR001005SANT/Myb domain
SuperFamilySSF466893.87E-191588IPR009057Homeodomain-like
CDDcd001674.33E-91661No hitNo description
PROSITE profilePS500904.50762105IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.5E-66388IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVGFLL THGHYCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDEEQQLVID LHAQLGNRKE ADTSEIAGRL IWLSRRRRKR KRHTEGHRSK  120
VGDESVDGVP ILDAAKRPPK LQETTHFKNG ASCTSKRRSL DDKPIAHGPE CPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-151299591B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110RRRRKRK
2105111RRRKRKR
3106111RRKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0089811e-142BT008981.2 Triticum aestivum clone wdk2c.pk006.d4:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965175.12e-55PREDICTED: protein ODORANT1-like
SwissprotQ50EX68e-51ODO1_PETHY; Protein ODORANT1
TrEMBLM7ZYI41e-125M7ZYI4_TRIUA; Protein ODORANT1
STRINGMLOC_14021.19e-59(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.16e-54myb domain protein 20